PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04551.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 799aa    MW: 88900.5 Da    PI: 6.7345
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04551.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.84.5e-075092347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I  +++  +   q++++++ +
        PK04551.1 50 AWTRQEEENFFTALRQVGKN-FEKITCRVQ-SKNKDQVRHYYYRL 92
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.17E-94397IPR009057Homeodomain-like
PROSITE profilePS5129312.4644697IPR017884SANT domain
SMARTSM007176.9E-54795IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-44895IPR009057Homeodomain-like
CDDcd001674.67E-55093No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MESRVILQSE AHLNSDTIAS QEREPGVSSS APINIVPQQP VKKQTRQWAA WTRQEEENFF  60
TALRQVGKNF EKITCRVQSK NKDQVRHYYY RLVRRMNKLL GPGLYLDAKN SKDTNAAMLR  120
WWSLLEKYSC KASKLHLKPR RFKIFIEALE HQLLKDRKKS VRKRPTNGDH SSPTPNTVIN  180
QGRTSGHESR TVKLVLVDSQ NIQKVGSGKA PLKRNVNLSI NRSNNKGDST TMKPARQQRR  240
KPGVVSSAAY KKWEKAAIAG VSLVADAAEH LERTSTDKEI EQNQSTSGQN KSSEPVGQVL  300
FSLPNFPQNP FAESNINSSM KLKLQLFPID DGTRRALEMD KLNPHLELTL SNRKRISSVL  360
ERLNRKWGSS KVASGELMLF PFSVQKENIV GHQSWTLDSV ASAADVYAMI GSPQVFRLRY  420
GWIPTAEHGF ATFQEQAPLP PRSISGEPNV NMEKRDQDMR GTTTMSVPST THQSMDLHED  480
NLVSVNKNHD SAFTSANVVL NEKRYSSAGP RDNLLDSCDP TASDKPWHGK GAGGETSMRQ  540
LRDTDDIRLS NGSGLSPGEW ADSLTNISVG DLLSGVSQDM NANGIDPPPA ESAHCLQQMP  600
FSCDSFDAAI AAHISRQQEK MGCQPTLVSS IWDAEETCDG FLFQKNRVWC HEMESPTGLT  660
TPNACKQTTE TNVMESIHLD EELSEVEEPT DDSARGDPMD DRGLDSQLLE NPAKDFSELA  720
DMYWPESLGP LDLDIPSSKY HSEDLILSDS LSGLNRLIAS SLDAFQNCSF FGLDKKESAS  780
TVEARESVSF SDFKIGSGL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107483.10.0hypothetical protein L484_024333
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLW9RWW70.0W9RWW7_9R
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98832531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.30.0TSL-kinase interacting protein 1